Return to main results Retrieve Phyre Job Id

Job DescriptionP0AGD7
Confidence96.88%DateThu Jan 5 11:28:50 GMT 2012
Rank277Aligned Residues142
% Identity20%Templatec3qq5A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:small gtp-binding protein; PDBTitle: crystal structure of the [fefe]-hydrogenase maturation protein hydf
Resolution2.99 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   93......100.........110.........120.........130.........140.........150.........160.........170..
Predicted Secondary structure 































Query SS confidence 















































































Query Sequence  LNLAAQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIV
Query Conservation         
 





  
 




 



     
 

 
 

 


 
 

 



  
   


        

  
 
Alig confidence 



























..............








.............







........
Template Conservation     
 
 
  
 


  










..............



   
 .............


     ........
Template Sequence  YTMRLGFRRYIVVAGRRNVGKSSFMNAL. . . . . . . . . . . . . . VGTDPVYKS. . . . . . . . . . . . . MELHPIGP. . . . . . . .
Template Known Secondary structure 








S
STTTTTTTTSS..............





.............TTT........
Template Predicted Secondary structure 












..............


.............



........
Template SS confidence 















































































  
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions