Return to main results Retrieve Phyre Job Id

Job DescriptionP39393
Confidence61.85%DateThu Jan 5 12:00:28 GMT 2012
Rank95Aligned Residues57
% Identity14%Templatec2w00B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:hsdr; PDBTitle: crystal structure of the hsdr subunit of the ecor124i2 restriction enzyme in complex with atp
Resolution2.6 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   615....620.........630.........640.........650.........660.........670.........680.........690....
Predicted Secondary structure 











































Query SS confidence 















































































Query Sequence  SERLQSYEKMFKNGQLNVLNCSTTMEMGVDTDRVMTLASRSQQATIPGPEWHLNDELVVRSLGYKTVELNEFILPAKATN
Query Conservation     

  
  

 
 














   

 



 





 





                      



Alig confidence 





























...










.








......................



Template Conservation        
          





 





... 
 
  




.


   
 
......................

 
Template Sequence  QNYYRDLAQRVKNQDIDLLIVVGXFLTGFD. . . APTLNTLFVDK. NLRYHGLXQ. . . . . . . . . . . . . . . . . . . . . . AFSR
Template Known Secondary structure  TTSSSSSTTSSS

...
TTS.


......................GG
Template Predicted Secondary structure 













...


.



......................
Template SS confidence 















































































   635....640.........650.........660.... .....670..... ....680.... ....
 
   695..
Predicted Secondary structure 


Query SS confidence 


Query Sequence  AVE
Query Conservation 


Alig confidence 


Template Conservation 


Template Sequence  TNR
Template Known Secondary structure  G

Template Predicted Secondary structure 
Template SS confidence 


   689690.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions