Return to main results Retrieve Phyre Job Id

Job DescriptionP39393
Confidence48.10%DateThu Jan 5 12:00:28 GMT 2012
Rank109Aligned Residues20
% Identity40%Templatec1i3qI_
PDB info PDB header:transcriptionChain: I: PDB Molecule:dna-directed rna polymerase ii 14.2kd PDBTitle: rna polymerase ii crystal form i at 3.1 a resolution
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910 ....... ..20........
Predicted Secondary structure 

.




.........




Query SS confidence 

.






. . . . . . . . .










Query Sequence  CD. CGSPVYE. . . . . . . . . VAFCNDCNEPH
Query Conservation 
 .




 
.........
  

 

  
Alig confidence 

.






.........










Template Conservation 

 




              
  
    
Template Sequence  CRDCNNMLYPREDKENNRLLFECRTCSYVE
Template Known Secondary structure 
SSS

BTTTTSSS

Template Predicted Secondary structure 




















Template SS confidence 





























   7..10.........20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions