Return to main results Retrieve Phyre Job Id

Job DescriptionP77692
Confidence5.17%DateThu Jan 5 12:31:42 GMT 2012
Rank59Aligned Residues24
% Identity13%Templated1sknp_
SCOP infoA DNA-binding domain in eukaryotic transcription factors A DNA-binding domain in eukaryotic transcription factors A DNA-binding domain in eukaryotic transcription factors
Resolution2.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   42.......50.........60.........70..
Predicted Secondary structure 






Query SS confidence 






























Query Sequence  PFCNEAVIKEHIDAGITLADAVNFLVEKYEL
Query Conservation     

 

   

 



  


 

 

 
Alig confidence 








.......














Template Conservation 


   

 .......


 

  

    
Template Sequence  PVSAFQISE. . . . . . . MSLSELQQVLKNESL
Template Known Secondary structure  SS
.......S
S

Template Predicted Secondary structure 


.......




Template SS confidence 






























   471........ 480.........490....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions