Return to main results Retrieve Phyre Job Id

Job DescriptionP77692
Confidence7.27%DateThu Jan 5 12:31:42 GMT 2012
Rank36Aligned Residues24
% Identity38%Templated1cipa1
SCOP infoTransducin (alpha subunit), insertion domain Transducin (alpha subunit), insertion domain Transducin (alpha subunit), insertion domain
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   71........80.........90.........100.
Predicted Secondary structure 













Query SS confidence 






























Query Sequence  ELVRIDRKGFSWQEQSPYLRAADILRARQAT
Query Conservation   
 
 
  


    

 

  
 



 
 
Alig confidence 











.......











Template Conservation   
 

   

 
.......
  


  
  
Template Sequence  DLDRIAQPNYIP. . . . . . . TQQDVLRTRVKT
Template Known Secondary structure  TTSTT


.......
T




Template Predicted Secondary structure 





.......



Template SS confidence 






























   158.160......... 170.........180.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions