Return to main results Retrieve Phyre Job Id

Job DescriptionP75733
Confidence2.29%DateThu Jan 5 12:13:33 GMT 2012
Rank56Aligned Residues36
% Identity28%Templatec3tzgA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein bvu_2266; PDBTitle: crystal structure of a hypothetical protein bvu_2266 (bvu_2266) from2 bacteroides vulgatus atcc 8482 at 2.80 a resolution
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   412.......420.........430.........440.........450.........460......
Predicted Secondary structure 



























Query SS confidence 






















































Query Sequence  DAVYTIQDGRAKGTMFKLHFTEYDNHSDIPSWGGGYGNIFQDERDVKFMVIAPFT
Query Conservation     
  
 
 




 
 
 
                    
    

 
 
 
 
Alig confidence 






....














...............













Template Conservation 




 
....














...............













Template Sequence  DIGYCXN. . . . HGLSTYNVHANYRLD. . . . . . . . . . . . . . . DENPVRIEVLYNYT
Template Known Secondary structure  G....GGT...............TTTTT
Template Predicted Secondary structure 

....



...............




Template SS confidence 






















































   224.....230 .........240..... ....250.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions