Return to main results Retrieve Phyre Job Id

Job DescriptionP75733
Confidence1.58%DateThu Jan 5 12:13:33 GMT 2012
Rank76Aligned Residues43
% Identity19%Templatec2ervA_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:hypothetical protein paer03002360; PDBTitle: crystal structure of the outer membrane enzyme pagl
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   358.360.........370.........380.........390.........400.........410........
Predicted Secondary structure 



























Query SS confidence 




























































Query Sequence  FFGAMYDLKNWNLPGFAIGASYVYAWDAKPATWQSNPDAYYDKNRTIEESAYSLDAVYTIQ
Query Conservation       


   




     
  
                         
 
    
  
Alig confidence 







....























..............










Template Conservation   

 
   ....     
  
  
 




   


.............. 
   
 
  
Template Sequence  RIGAGLKF. . . . ANGQSVGVRAIHYSNAGLKQPNDG. . . . . . . . . . . . . . IESYSLFYKIP
Template Known Secondary structure  ....TTS

TTSSTT


..............
Template Predicted Secondary structure 
....













..............

Template SS confidence 




























































   107..110.... .....120.........130........ .140.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions