Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB10
Confidence2.27%DateThu Jan 5 11:14:18 GMT 2012
Rank35Aligned Residues24
% Identity21%Templated1gpqa_
SCOP infoInhibitor of vertebrate lysozyme, Ivy Inhibitor of vertebrate lysozyme, Ivy Inhibitor of vertebrate lysozyme, Ivy
Resolution1.6

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   74.....80...... ...90.......
Predicted Secondary structure 







.......
Query SS confidence 












. . . . . . .










Query Sequence  ANNNLWASPLDQQ. . . . . . . LRNTLVANLST
Query Conservation      

   
   .......
   
   
  
Alig confidence 












.......










Template Conservation   
   


 

   


   
 
 
   
 
Template Sequence  QEKLTWLNVNDALSIDGKTVLFAALTGSLEN
Template Known Secondary structure  S

GGGTTS
Template Predicted Secondary structure 








Template SS confidence 






























   91........100.........110.........120.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions