Return to main results Retrieve Phyre Job Id

Job DescriptionQ2EEQ8
Confidence19.54%DateThu Jan 5 12:33:44 GMT 2012
Rank7Aligned Residues32
% Identity25%Templatec3hefB_
PDB info PDB header:viral proteinChain: B: PDB Molecule:gene 1 protein; PDBTitle: crystal structure of the bacteriophage sf6 terminase small2 subunit
Resolution1.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70......
Predicted Secondary structure 












Query SS confidence 














































Query Sequence  LLLTICAVISGAEGWEDIEDFGETHLDFLKQYGDFENGIPVHDTIAR
Query Conservation 
 


 


 

 
   
  
       

  
 
  



 

  
Alig confidence 

















...............













Template Conservation    
 
   

 
 

  
...............
   



  
   
Template Sequence  VADDICSLLSSGESLLKV. . . . . . . . . . . . . . . CKRPGMPDKSTVFR
Template Known Secondary structure  TT

...............TTSTT


Template Predicted Secondary structure 

...............




Template SS confidence 














































   17..20.........30.... .....40........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions