Return to main results Retrieve Phyre Job Id

Job DescriptionP13979
Confidence8.28%DateThu Jan 5 11:33:52 GMT 2012
Rank27Aligned Residues22
% Identity32%Templatec3jt0B_
PDB info PDB header:structural proteinChain: B: PDB Molecule:lamin-b1; PDBTitle: crystal structure of the c-terminal fragment (426-558)2 lamin-b1 from homo sapiens, northeast structural genomics3 consortium target hr5546a
Resolution2.39 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.......
Predicted Secondary structure 








Query SS confidence 
































Query Sequence  FLQIKNTSDKDMSGLQGKIADAVKAKGYQVVTS
Query Conservation 

 




  
   
   
   
   




  
Alig confidence 













...........







Template Conservation   
 
 
       
........... 

 
   
Template Sequence  FIRLKNTSEQDQPX. . . . . . . . . . . GGWEXIRK
Template Known Secondary structure 
SSS

...........TT
Template Predicted Secondary structure 







...........


Template SS confidence 
































   3940.........50.. .......60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions