Return to main results Retrieve Phyre Job Id

Job DescriptionP37177
Confidence42.92%DateThu Jan 5 11:54:54 GMT 2012
Rank175Aligned Residues31
% Identity19%Templatec3iz5H_
PDB info PDB header:ribosomeChain: H: PDB Molecule:60s ribosomal protein l7a (l7ae); PDBTitle: localization of the large subunit ribosomal proteins into a 5.5 a2 cryo-em map of triticum aestivum translating 80s ribosome
Resolution5.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   322.......330.........340.........350.........360.........370
Predicted Secondary structure 


















Query SS confidence 
















































Query Sequence  RFILVADELSATTLAELPQDRLVGVVVRDGAANSHAAIMVRALGIPTVM
Query Conservation    



  
 

    
    
 



  

 


 












Alig confidence 













..................
















Template Conservation   




 






..................
 


 

    


  
Template Sequence  QLVVIAHDVDPIEL. . . . . . . . . . . . . . . . . . VVWLPALCRKMEVPYCI
Template Known Secondary structure  S

SST..................TTTT

Template Predicted Secondary structure 



..................



Template SS confidence 
















































   145....150........ .160.........170.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions