Return to main results Retrieve Phyre Job Id

Job DescriptionP0AGC5
Confidence48.17%DateThu Jan 5 11:28:45 GMT 2012
Rank203Aligned Residues52
% Identity31%Templatec4a56A_
PDB info PDB header:protein transportChain: A: PDB Molecule:pullulanase secretion protein puls; PDBTitle: crystal structure of the type 2 secretion system pilotin2 from klebsiella oxytoca
Resolution1.24 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   352.......360.........370.........380.........390.........400......... 410.........420...
Predicted Secondary structure 













.





Query SS confidence 

























































.













Query Sequence  SISGGVRYLQDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWA. DVKQRLPLLSQKPY
Query Conservation   
  
  

  
                





 
 
 
  
       
  
  
 .              
Alig confidence 














..








.............











.....

.













Template Conservation 





 


  
 
..





  
.............  


 

  

.....
 
     
 
 
  

Template Sequence  SVAAGARYLKNKCNR. . SDLPADEAI. . . . . . . . . . . . . NRAAINVGKKRG. . . . . WANIDANLLSQRSAQLY
Template Known Secondary structure  S

..TTS

.............T.....




Template Predicted Secondary structure 


..




.............

.....


Template SS confidence 








































































   41........50..... ....60.... .....70...... ...80.........90...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions