Return to main results Retrieve Phyre Job Id

Job DescriptionP31460
Confidence60.19%DateThu Jan 5 11:47:50 GMT 2012
Rank364Aligned Residues33
% Identity18%Templatec3nxcA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:hth-type protein slma; PDBTitle: molecular mechanism by which the escherichia coli nucleoid occlusion2 factor, slma, keeps cytokinesis in check
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.....
Predicted Secondary structure 















Query SS confidence 









































Query Sequence  NKTDRIVITLGKQIVHGKYVPGSPLPAEAELCEEFATSRNII
Query Conservation 
  


   
   
  
 
 

  



  

   



 

Alig confidence 













........


.















Template Conservation   

  

 

    ........   .
   

  



  

Template Sequence  NRREEILQSLALML. . . . . . . . ESI. TTAKLAASVGVSEAAL
Template Known Secondary structure  TT........

.
TTS
Template Predicted Secondary structure 
.........


Template SS confidence 









































   24.....30....... ..40 .........50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions