Return to main results Retrieve Phyre Job Id

Job DescriptionP75672
Confidence64.14%DateThu Jan 5 12:12:51 GMT 2012
Rank312Aligned Residues44
% Identity18%Templatec2qy6A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:upf0209 protein yfck; PDBTitle: crystal structure of the n-terminal domain of upf0209 protein yfck2 from escherichia coli o157:h7
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   107..110.........120.........130.........140.........150.........160.........170.......
Predicted Secondary structure 

























Query SS confidence 






































































Query Sequence  HRLLREADRVLIDDGWLVISGFNPISFMGLRKLVPVLRKTSPYNSRMFTLMRQLDWLSLLNFEVLHASRFH
Query Conservation     
 
  


 


 
 
   

 
   
                  
   
   
   



       
Alig confidence 


















...........................
























Template Conservation   
 
  

     

 
 
...........................

 

 


 
  


 
 
 

 
Template Sequence  QNLFNAMARLARPGGTLAT. . . . . . . . . . . . . . . . . . . . . . . . . . . FTSAGFVRRGLQEAGFTMQKRKGFG
Template Known Secondary structure  ...........................S


T

ST
Template Predicted Secondary structure 




...........................








Template SS confidence 






































































   211........220......... 230.........240.........250....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions