Return to main results Retrieve Phyre Job Id

Job DescriptionP32675
Confidence24.39%DateThu Jan 5 11:50:03 GMT 2012
Rank256Aligned Residues47
% Identity23%Templatec3l23A_
PDB info PDB header:isomeraseChain: A: PDB Molecule:sugar phosphate isomerase/epimerase; PDBTitle: crystal structure of sugar phosphate isomerase/epimerase2 (yp_001303399.1) from parabacteroides distasonis atcc 8503 at 1.70 a3 resolution
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   225....230.........240.........250.........260.........270.........280.........
Predicted Secondary structure 



























Query SS confidence 
































































Query Sequence  NMQQALDVLIPLNIRQIHLLPFHQYGEPKYRLLGKTWSMKEVPAPSSADVATMREMAERAGLQVT
Query Conservation 

  
   
  

   
 
 
  
 
  
   
           
  
 
          
  
 
Alig confidence 























..................






















Template Conservation 
    
   

 

 



     ..................          
   
   

   
Template Sequence  DVAANLRKVKDXGYSKLELAGYGK. . . . . . . . . . . . . . . . . . GAIGGVPXXDFKKXAEDAGLKII
Template Known Secondary structure 
TT



T..................TTTTT
Template Predicted Secondary structure 








..................









Template SS confidence 
































































   61........70.........80.... .....90.........100.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions