Return to main results Retrieve Phyre Job Id

Job DescriptionP76102
Confidence75.93%DateThu Jan 5 12:18:56 GMT 2012
Rank71Aligned Residues39
% Identity18%Templatec3gn5B_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:hth-type transcriptional regulator mqsa (ygit/b3021); PDBTitle: structure of the e. coli protein mqsa (ygit/b3021)
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   314.... .320........ .330.........340.........350..
Predicted Secondary structure 




..............









.






Query SS confidence 




. . . . . . . . . . . . . .









.























Query Sequence  CAYCG. . . . . . . . . . . . . . HTAKENRLSQ. SKFRCQVCGYTANADVNGARNILA
Query Conservation 
  

..............          .
   
  

    

 


 


 
Alig confidence 




..............









.























Template Conservation 

 

               

    
       
  


              
Template Sequence  CPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQ
Template Known Secondary structure 
TTTSSSBTTTTT



Template Predicted Secondary structure 



















Template SS confidence 





















































   3......10.........20.........30.........40.........50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions