Return to main results Retrieve Phyre Job Id

Job DescriptionP76102
Confidence43.83%DateThu Jan 5 12:18:56 GMT 2012
Rank202Aligned Residues23
% Identity30%Templatec3c5kA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:histone deacetylase 6; PDBTitle: crystal structure of human hdac6 zinc finger domain
Resolution1.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   311........320.........330.........340
Predicted Secondary structure 























Query SS confidence 





























Query Sequence  SQRCAYCGHTAKENRLSQSKFRCQVCGYTA
Query Conservation 

 
  

          
   
  

   
Alig confidence 










.......











Template Conservation     
  
    ....... 

 

 

 

Template Sequence  TQPCGDCGTIQ. . . . . . . ENWVCLSCYQVY
Template Known Secondary structure  T


TTT


S.......STTT

Template Predicted Secondary structure 










.......



Template SS confidence 





























   22.......30.. .......40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions