Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAJ1
Confidence7.61%DateThu Jan 5 11:13:03 GMT 2012
Rank82Aligned Residues25
% Identity12%Templatec1g8jC_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:arsenite oxidase; PDBTitle: crystal structure analysis of arsenite oxidase from2 alcaligenes faecalis
Resolution2.03 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   118.120.........130.........140.........150.
Predicted Secondary structure 




















Query SS confidence 

































Query Sequence  AEKGHMTKCDGCYSRVAEGKQPICVESCPLRALE
Query Conservation         

  
  
   
  



  

  

 
Alig confidence 












.........











Template Conservation 
        
 
 ......... 
   

    
Template Sequence  PPANAQRTNMTCH. . . . . . . . . FCIVGCGYHVYK
Template Known Secondary structure 

TT

S.........SBTT

Template Predicted Secondary structure 






.........







Template SS confidence 

































   10.........20.. .......30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions