Return to main results Retrieve Phyre Job Id

Job DescriptionQ2M7X4
Confidence4.92%DateThu Jan 5 12:34:02 GMT 2012
Rank20Aligned Residues32
% Identity25%Templatec1rm1C_
PDB info PDB header:transcription/dnaChain: C: PDB Molecule:transcription initiation factor iia large chain; PDBTitle: structure of a yeast tfiia/tbp/tata-box dna complex
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.........60....
Predicted Secondary structure 









Query SS confidence 










































Query Sequence  ESPFSSLQSAKEKTTVLQDLRKICTPQASLSDEAWEKLMLSDE
Query Conservation 

   


 

 

 

 


  
 
 
 



      



Alig confidence 






















...........








Template Conservation    

 








 

 


  ...........

 

 

 
Template Sequence  NEVREDFENAGIDEQTLQDLKNI. . . . . . . . . . . WQKKLTETK
Template Known Secondary structure  T

...........T
Template Predicted Secondary structure 



...........

Template SS confidence 










































   1920.........30.........40. ........50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions