Return to main results Retrieve Phyre Job Id

Job DescriptionP22709
Confidence4.77%DateThu Jan 5 11:39:04 GMT 2012
Rank12Aligned Residues22
% Identity32%Templatec2yqyB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:hypothetical protein ttha0303; PDBTitle: crystal structure of tt2238, a four-helix bundle protein
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50..
Predicted Secondary structure 





Query SS confidence 


































Query Sequence  TDTWLQSLLVWSPGQRDIIKTVALVLMVLDHANRI
Query Conservation                  



 



 
 



   
Alig confidence 








.




............







Template Conservation           .


 
............




   
Template Sequence  DPAWLSAPA. WTPLM. . . . . . . . . . . . VAEHVALV
Template Known Secondary structure 
TTTTT


.

............
Template Predicted Secondary structure 





.

............
Template SS confidence 


































   32.......40 ..... ....50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions