Return to main results Retrieve Phyre Job Id

Job DescriptionP22709
Confidence2.52%DateThu Jan 5 11:39:04 GMT 2012
Rank53Aligned Residues37
% Identity24%Templatec1shzF_
PDB info PDB header:signaling proteinChain: F: PDB Molecule:rho guanine nucleotide exchange factor 1; PDBTitle: crystal structure of the p115rhogef rgrgs domain in a2 complex with galpha(13):galpha(i1) chimera
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   40.........50.........60.........70.........80.........90
Predicted Secondary structure 








Query SS confidence 


















































Query Sequence  ALVLMVLDHANRILHLDQSWMFLAGRGAFPLFALVWGLNLSRHAHIRQLAI
Query Conservation 


 
 



   
      
  








 
 




 


 
 



Alig confidence 
















............










.
.







Template Conservation 






 

 

 


............





 

 
. . 

 



Template Sequence  AHLMALLQHVALQFEPG. . . . . . . . . . . . PLLCCLHADML. G. PKEAKKAF
Template Known Secondary structure  S
S............TT.
.

T
Template Predicted Secondary structure 




.............
.
Template SS confidence 


















































   57..60.........70... ......80.... . ....90...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions