Return to main results Retrieve Phyre Job Id

Job DescriptionP33221
Confidence94.66%DateWed Jan 25 15:20:50 GMT 2012
Rank444Aligned Residues49
% Identity27%Templatec2zklA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:capsular polysaccharide synthesis enzyme cap5f; PDBTitle: crystal structure of capsular polysaccharide assembling protein capf2 from staphylococcus aureus
Resolution2.61 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20 .........30.........40.........50.........60.........70.........80
Predicted Secondary structure 

.


















Query SS confidence 






.



























































Query Sequence  RVMLLGS. GELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVELEKPHYIV
Query Conservation   




 .
  
     

   
  
  

          

        
   
         
 

Alig confidence 






.






















................












..





Template Conservation 












 

  
   
  

    ................
  
   
  
  ..  
 

Template Sequence  NIVITGAKGFVGKNLKADLTSTTDHHIFEVH. . . . . . . . . . . . . . . . RQTKEEELESALL. . KADFIV
Template Known Secondary structure  TTTS



................TT

..
S
Template Predicted Secondary structure 








................




..


Template SS confidence 



































































   2.......10.........20.........30.. .......40..... ....50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions