Return to main results Retrieve Phyre Job Id

Job DescriptionP33221
Confidence97.16%DateWed Jan 25 15:20:50 GMT 2012
Rank139Aligned Residues66
% Identity26%Templatec2ydyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:methionine adenosyltransferase 2 subunit beta; PDBTitle: crystal structure of human s-adenosylmethionine synthetase2 2, beta subunit in orthorhombic crystal form
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20 .........30.........40.........50.........60.........70.........80.........90
Predicted Secondary structure 


.






















Query SS confidence 








.





































































Query Sequence  ATRVMLLGS. GELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVELEKPHYIVPEIEAIATDM
Query Conservation     




 .
  
     

   
  
  

          

        
   
         
 

   
      
Alig confidence 








.























........................





















Template Conservation   









 

  
   
   
  
    
 ........................  
     
 


 
       
Template Sequence  NRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGVH. . . . . . . . . . . . . . . . . . . . . . . . HIIHDFQPHVIVHCAVDASGNL
Template Known Secondary structure 

TTTSTTT


........................

S


Template Predicted Secondary structure 








........................












Template SS confidence 















































































   28.30.........40.........50.........60. ........70.........80...
 
   91........100.
Predicted Secondary structure 



Query SS confidence 










Query Sequence  LIQLEEEGLNV
Query Conservation     
   
   
Alig confidence 










Template Conservation             
Template Sequence  AKEAAAVGAFL
Template Known Secondary structure  T
Template Predicted Secondary structure 






Template SS confidence 










   121........130.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions