Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6A3
Confidence25.00%DateThu Jan 5 11:02:41 GMT 2012
Rank135Aligned Residues58
% Identity24%Templatec2oudA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:dual specificity protein phosphatase 10; PDBTitle: crystal structure of the catalytic domain of human mkp5
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   187..190.........200.........210.........220.........230.........240.........250.........260......
Predicted Secondary structure 


































Query SS confidence 















































































Query Sequence  FYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDAI
Query Conservation    

   
  


       





 
 

 

  








 





 





 


  
  
      
  
 
Alig confidence 





























..........................




...















Template Conservation            
         




  
 
..........................

  
...
 



     
  

Template Sequence  RQYFEEAFEFIEEAHQCGKGLLIHCQAGVS. . . . . . . . . . . . . . . . . . . . . . . . . . RSATI. . . VIAYLMKHTRMTMTDA
Template Known Secondary structure  TT

SSSSS.............................TS


Template Predicted Secondary structure 










.............................



Template SS confidence 















































































   384.....390.........400.........410... ..... .420.........430....
 
   267..270...
Predicted Secondary structure 

Query SS confidence 






Query Sequence  NKLLTKE
Query Conservation     
   
Alig confidence 






Template Conservation     
   
Template Sequence  YKFVKGK
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 






   435....440.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions