Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6A3
Confidence98.17%DateThu Jan 5 11:02:41 GMT 2012
Rank20Aligned Residues255
% Identity14%Templatec2ap1A_
PDB info PDB header:transferaseChain: A: PDB Molecule:putative regulator protein; PDBTitle: crystal structure of the putative regulatory protein
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60.........70.........80..
Predicted Secondary structure 


































Query SS confidence 















































































Query Sequence  SKLVLVLNCGSSSLKFAIIDAVNGEEYLSGLAECFHLPEARIKWKMDGNKQEAALGAGAAHSEALNFIVNTILAQKPELS
Query Conservation     




 



 
 


       
  
  
 
                            
   
   
        
Alig confidence 



















.












......................















.






Template Conservation      



 


     
 
.  
 
        ......................           
   
.       
Template Sequence  NAMYYGFDIGGTKIALGVFD. STRRLQWEKRVPT. . . . . . . . . . . . . . . . . . . . . . PHTSYSAFLDAVCELV. EEADQRF
Template Known Secondary structure 


SS.TT


......................

S
.
Template Predicted Secondary structure 





.





......................



.
Template SS confidence 















































































  
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions