Return to main results Retrieve Phyre Job Id

Job DescriptionP64612
Confidence94.51%DateThu Jan 5 12:09:55 GMT 2012
Rank232Aligned Residues38
% Identity21%Templatec2qenA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:walker-type atpase; PDBTitle: the walker-type atpase paby2304 of pyrococcus abyssi
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70.........80.........90......
Predicted Secondary structure 



























Query SS confidence 


































































Query Sequence  SRLEIIYQELINSTPPAPRTSGLMARVGKLWGKREDTKHTPVRGLYMWGGVGRGKTWLMDLFYQSLP
Query Conservation    
  
   
                               





 
 

 


 


 
     
Alig confidence 











.............................

























Template Conservation   

  
   
  .............................   
 
 
  
 




         
Template Sequence  EESRKLEESLEN. . . . . . . . . . . . . . . . . . . . . . . . . . . . . YPLTLLLGIRRVGKSSLLRAFLNERP
Template Known Secondary structure  .............................
S

TTSSSS
Template Predicted Secondary structure 
.............................









Template SS confidence 


































































   1920.........30 .........40.........50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions