Return to main results Retrieve Phyre Job Id

Job DescriptionP64612
Confidence98.15%DateThu Jan 5 12:09:55 GMT 2012
Rank63Aligned Residues47
% Identity32%Templatec2c9oC_
PDB info PDB header:hydrolaseChain: C: PDB Molecule:ruvb-like 1; PDBTitle: 3d structure of the human ruvb-like helicase ruvbl1
Resolution2.2 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50.........60.........70.........80.........90......
Predicted Secondary structure 



























Query SS confidence 







































































Query Sequence  QKEAVSRLEIIYQELINSTPPAPRTSGLMARVGKLWGKREDTKHTPVRGLYMWGGVGRGKTWLMDLFYQSLP
Query Conservation 
  
   
  
   
                               





 
 

 


 


 
     
Alig confidence 















.........................






























Template Conservation 

     
   
  
 .........................        


 







 

 


  
 
Template Sequence  QENAREACGVIVELIK. . . . . . . . . . . . . . . . . . . . . . . . . SKKMAGRAVLLAGPPGTGKTALALAIAQELG
Template Known Secondary structure 
.........................TT

TT


TTSS
Template Predicted Secondary structure  .........................













Template SS confidence 







































































   42.......50....... ..60.........70.........80........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions