Return to main results Retrieve Phyre Job Id

Job DescriptionP64612
Confidence91.89%DateThu Jan 5 12:09:55 GMT 2012
Rank307Aligned Residues40
% Identity25%Templatec1z6tC_
PDB info PDB header:apoptosisChain: C: PDB Molecule:apoptotic protease activating factor 1; PDBTitle: structure of the apoptotic protease-activating factor 12 bound to adp
Resolution2.21 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70.........80.........90....
Predicted Secondary structure 

























Query SS confidence 
































































Query Sequence  SRLEIIYQELINSTPPAPRTSGLMARVGKLWGKREDTKHTPVRGLYMWGGVGRGKTWLMDLFYQS
Query Conservation    
  
   
                               





 
 

 


 


 
   
Alig confidence 










.........................




























Template Conservation       
   
 .........................        
 
 
  
 





      
Template Sequence  KLVNAIQQKLS. . . . . . . . . . . . . . . . . . . . . . . . . KLKGEPGWVTIHGMAGCGKSVLAAEAVRD
Template Known Secondary structure  T.........................TSTTS


TTSS

Template Predicted Secondary structure  .........................












Template SS confidence 
































































   131........140. ........150.........160.........170
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions