Return to main results Retrieve Phyre Job Id

Job DescriptionP64612
Confidence82.84%DateThu Jan 5 12:09:55 GMT 2012
Rank441Aligned Residues41
% Identity24%Templatec1z63A_
PDB info PDB header:hydrolase/dna complexChain: A: PDB Molecule:helicase of the snf2/rad54 hamily; PDBTitle: sulfolobus solfataricus swi2/snf2 atpase core in complex2 with dsdna
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   23......30.........40.........50.........60.........70.........80.........90.....
Predicted Secondary structure 


























Query SS confidence 








































































Query Sequence  DVQKEAVSRLEIIYQELINSTPPAPRTSGLMARVGKLWGKREDTKHTPVRGLYMWGGVGRGKTWLMDLFYQSL
Query Conservation    
  
   
  
   
                               





 
 

 


 


 
    
Alig confidence 















................................
























Template Conservation   

  

         ................................    



  
 


  

  
   
Template Sequence  PYQIKGFSWXRFXNKL. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GFGICLADDXGLGKTLQTIAVFSDA
Template Known Secondary structure  T................................T




TTS
Template Predicted Secondary structure 
................................







Template SS confidence 








































































   446...450.........460. ........470.........480......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions