Return to main results Retrieve Phyre Job Id

Job DescriptionP64612
Confidence94.61%DateThu Jan 5 12:09:55 GMT 2012
Rank230Aligned Residues31
% Identity26%Templatec1uaaB_
PDB info PDB header:hydrolase/dnaChain: B: PDB Molecule:protein (atp-dependent dna helicase rep.); PDBTitle: e. coli rep helicase/dna complex
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   20.........30.........40.........50.........60.........70.........80........
Predicted Secondary structure 




























Query SS confidence 




































































Query Sequence  QPDDVQKEAVSRLEIIYQELINSTPPAPRTSGLMARVGKLWGKREDTKHTPVRGLYMWGGVGRGKTWLM
Query Conservation    
  
  
   
  
   
                               





 
 

 


 

Alig confidence 











......................................


















Template Conservation   
   
  

  ......................................     

 
 





   
Template Sequence  RLNPGQQQAVEF. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . VTGPCLVLAGAGSGKTRVI
Template Known Secondary structure 



......................................
SS

TTS
Template Predicted Secondary structure 



......................................








Template SS confidence 




































































   2.......10... ......20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions