Return to main results Retrieve Phyre Job Id

Job DescriptionP64612
Confidence95.00%DateThu Jan 5 12:09:55 GMT 2012
Rank213Aligned Residues53
% Identity28%Templatec1gm5A_
PDB info PDB header:helicaseChain: A: PDB Molecule:recg; PDBTitle: structure of recg bound to three-way dna junction
Resolution3.24 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.........60.........70.........80.......
Predicted Secondary structure 
































Query SS confidence 















































































Query Sequence  SQYLKALNEGSHQPDDVQKEAVSRLEIIYQELINSTPPAPRTSGLMARVGKLWGKREDTKHTPVRGLYMWGGVGRGKTWL
Query Conservation    
   
  
 
  
  
  
   
  
   
                               





 
 

 


 
Alig confidence 
























..............................
























Template Conservation       
   


 

  
  

 

..............................  

     
 











 
Template Sequence  KLAEEFIKSLPFKLTNAQKRAHQEI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . RNDMISEKPMNRLLQGDVGSGKTVV
Template Known Secondary structure  SSS


..............................SSS





SSSS
Template Predicted Secondary structure 





..............................










Template SS confidence 















































































   356...360.........370.........380 .........390.........400.....
 
   88.90
Predicted Secondary structure 
Query SS confidence 


Query Sequence  MDL
Query Conservation 

 
Alig confidence 


Template Conservation 
 
Template Sequence  AQL
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 


   406..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions