Return to main results Retrieve Phyre Job Id

Job DescriptionP0AA93
Confidence39.21%DateThu Jan 5 11:12:15 GMT 2012
Rank117Aligned Residues23
% Identity30%Templatec1ut8B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:exodeoxyribonuclease; PDBTitle: divalent metal ions (zinc) bound to t5 5'-exonuclease
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   494.....500.........510.........520.........530.
Predicted Secondary structure 















Query SS confidence 





































Query Sequence  RDTGHGIDPKVIERVEANEMPGNKIGLLNVHHRVKLLY
Query Conservation   
 
 

       

  
  





      
   
Alig confidence 







...............














Template Conservation 






 ...............


 


 


  

Template Sequence  GDNIRGVE. . . . . . . . . . . . . . . GIGAKRGYNIIREFG
Template Known Secondary structure  TTTB


T...............T


Template Predicted Secondary structure 







...............



Template SS confidence 





































   203......210 .........220.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions