Return to main results Retrieve Phyre Job Id

Job DescriptionP76064
Confidence7.31%DateThu Jan 5 12:18:04 GMT 2012
Rank37Aligned Residues25
% Identity24%Templated1tp6a_
SCOP infoCystatin-like NTF2-like PA1314-like
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.........70.........80...
Predicted Secondary structure 





Query SS confidence 






























Query Sequence  NIYHRWLKGETKTQREKIQKLIPAILAILPR
Query Conservation 


 


  

   
 
   
 







 
Alig confidence 











......












Template Conservation    

 

 

  ......   
  
   
 
Template Sequence  VAIRDWLAGDSR. . . . . . ADALDALMARFAE
Template Known Secondary structure  T


......TTTT
Template Predicted Secondary structure 




......

Template SS confidence 






























   14.....20..... ....30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions