Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACN2
Confidence23.74%DateThu Jan 5 11:18:35 GMT 2012
Rank290Aligned Residues30
% Identity30%Templated1t98a1
SCOP infoDNA/RNA-binding 3-helical bundle "Winged helix" DNA-binding domain MukF N-terminal domain-like
Resolution2.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70.........80.........90.........100.
Predicted Secondary structure 








Query SS confidence 





































Query Sequence  AQSLQALEQDGFLNRIAYPVVPPHVEYSLTPLGEQVSE
Query Conservation 
 

  
   


 
      
  
 
 

  
  
  
Alig confidence 

















........











Template Conservation 




 











........











Template Sequence  NNAINDXVRQRLLNRFTI. . . . . . . . YRLTPLGIGITD
Template Known Secondary structure  TS


........
Template Predicted Secondary structure 

........
Template SS confidence 





































   75....80.........90.. .......100....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions