Return to main results Retrieve Phyre Job Id

Job DescriptionP77087
Confidence2.60%DateThu Jan 5 12:25:31 GMT 2012
Rank63Aligned Residues34
% Identity21%Templatec3p45F_
PDB info PDB header:hydrolaseChain: F: PDB Molecule:caspase-6; PDBTitle: crystal structure of apo-caspase-6 at physiological ph
Resolution2.53 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........
Predicted Secondary structure 







Query SS confidence 












































Query Sequence  HSDIEIAWYASIQQEPNGWKTVTTQFYIQEFSEYIAPLQDAVDLE
Query Conservation   







 














 


 


    





 
Alig confidence 








...........
























Template Conservation   

 

 

...........
  





 

          

 
Template Sequence  GADFLMCYS. . . . . . . . . . . VVNGSWYIQDLCEMLGKYGSSLEFT
Template Known Secondary structure 
TT

...........




TTTSB
Template Predicted Secondary structure 



...........









Template SS confidence 












































   203......210. ........220.........230......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions