Return to main results Retrieve Phyre Job Id

Job DescriptionP00490
Confidence8.10%DateThu Jan 5 10:56:40 GMT 2012
Rank99Aligned Residues30
% Identity20%Templatec2diiA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:tfiih basal transcription factor complex p62 PDBTitle: solution structure of the bsd domain of human tfiih basal2 transcription factor complex p62 subunit
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   458.460.........470.........480.........490.........500....
Predicted Secondary structure 









Query SS confidence 














































Query Sequence  IKQCNPALAALLDKSLQKEWANDLDQLINLEKFADDAKFRQQYREIK
Query Conservation 
  


 
  
    

  
  
   
  
    

      
   
Alig confidence 






















.................






Template Conservation 

 


 
 








 


 .................




 
Template Sequence  MLQEDPVLFQLYKDLVVSQVISA. . . . . . . . . . . . . . . . . EEFWANR
Template Known Secondary structure 
TTTSS
.................
Template Predicted Secondary structure 



.................
Template SS confidence 














































   22.......30.........40.... .....50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions