Return to main results Retrieve Phyre Job Id

Job DescriptionP33366
Confidence4.47%DateThu Jan 5 11:52:07 GMT 2012
Rank13Aligned Residues44
% Identity23%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   121........130.........140.........150.........160.........170.........180....
Predicted Secondary structure 
Query SS confidence 































































Query Sequence  KIFLPLNILGAFAWALIFTTIGYAGGQVIAPWLHNLDQHLKHWVWLILVVVLVVGVRWWLKRRG
Query Conservation    
     

           
   
                                    
 
Alig confidence 








.














...................



















Template Conservation 
 


 
 
.




 







 ...................    
          




Template Sequence  KVLTIIATI. FMPLTFIAGIYGYPV. . . . . . . . . . . . . . . . . . . VLAVMGVIAVIMVVYFKKKK
Template Known Secondary structure  .TTS


...................TTTTS

Template Predicted Secondary structure  ....................

Template SS confidence 































































   292.......300 .........310..... ....320.........330.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions