Return to main results Retrieve Phyre Job Id

Job DescriptionP0A832
Confidence8.72%DateThu Jan 5 11:06:45 GMT 2012
Rank20Aligned Residues26
% Identity23%Templatec2w3zA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative deacetylase; PDBTitle: structure of a streptococcus mutans ce4 esterase
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   90... ......100.........110.....
Predicted Secondary structure  ........



Query SS confidence 



. . . . . . . .





















Query Sequence  LLLN. . . . . . . . QRELDSLYGRVNREGYTVVALS
Query Conservation 



........
 

 

      

 




 
Alig confidence 



........





















Template Conservation 

 

      
   
  

  

  

 



 
Template Sequence  VLMHDISEKTITLASLPQIIRYYKDRGYTFAVLK
Template Known Secondary structure 
STT
TT


Template Predicted Secondary structure 











Template SS confidence 

































   278.280.........290.........300.........310.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions