Return to main results Retrieve Phyre Job Id

Job DescriptionP07013
Confidence12.62%DateThu Jan 5 10:59:59 GMT 2012
Rank80Aligned Residues19
% Identity11%Templatec2ftcH_
PDB info PDB header:ribosomeChain: H: PDB Molecule:39s ribosomal protein l13, mitochondrial; PDBTitle: structural model for the large subunit of the mammalian mitochondrial2 ribosome
Resolution12.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   56...60....... ..70....
Predicted Secondary structure 


............


Query SS confidence 











. . . . . . . . . . . .






Query Sequence  GHENQAITHSIT. . . . . . . . . . . . VGSRITV
Query Conservation 
  

     
 ............

  
 
Alig confidence 











............






Template Conservation 




 


 
 




 
 
  
 

 


Template Sequence  GKLAAMASIRLQGLHKPVYHALSDCGDHVVI
Template Known Secondary structure  TTTTTTSSS
SSS


TTS




Template Predicted Secondary structure 















Template SS confidence 






























   2930.........40.........50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions