Return to main results Retrieve Phyre Job Id

Job DescriptionP45795
Confidence4.80%DateThu Jan 5 12:03:46 GMT 2012
Rank30Aligned Residues33
% Identity24%Templatec1en4C_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:manganese superoxide dismutase; PDBTitle: crystal structure analysis of the e. coli manganese2 superoxide dismutase q146h mutant
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   37..40.........50.........60.........70.........80....
Predicted Secondary structure 













Query SS confidence 















































Query Sequence  GESLAYRFTGDTPEQWLASFRQHRWDLEEEAENLIQEQSEDDQGWVWL
Query Conservation   


   

    
     
   
 



 

 


       
 
 
Alig confidence 









.........














.....


.




Template Conservation     
   


......... 
 

  
   
   ..... 

.




Template Sequence  KAAIERDFGS. . . . . . . . . VDNFKAEFEKAAASR. . . . . FGS. GWAWL
Template Known Secondary structure  SS.........
.....
SS.
Template Predicted Secondary structure 

.........
.....


.
Template SS confidence 















































   99100........ .110.........120... ... ...130.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions