Return to main results Retrieve Phyre Job Id

Job DescriptionP37903
Confidence17.27%DateThu Jan 5 11:57:44 GMT 2012
Rank43Aligned Residues28
% Identity18%Templated2fywa1
SCOP infoNIF3 (NGG1p interacting factor 3)-like NIF3 (NGG1p interacting factor 3)-like NIF3 (NGG1p interacting factor 3)-like
Resolution2.40

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........
Predicted Secondary structure 







Query SS confidence 




































Query Sequence  RTILVPIDISDSELTQRVISHVEEEAKIDDAEVHFLT
Query Conservation 
 


 

 
 
  
  

  
  

      
  

Alig confidence 








.....









....








Template Conservation    
 



 .....
  

  

 ....   





Template Sequence  QRVXVALDI. . . . . REETVAEAIE. . . . KGVDLIIVK
Template Known Secondary structure  SS

.....
....TT
SS
Template Predicted Secondary structure 

.....
....



Template SS confidence 




































   37..40..... ....50..... ....60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions