Return to main results Retrieve Phyre Job Id

Job DescriptionP37903
Confidence10.57%DateThu Jan 5 11:57:44 GMT 2012
Rank75Aligned Residues28
% Identity11%Templatec2yybA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein ttha1606; PDBTitle: crystal structure of ttha1606 from thermus thermophilus hb8
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........
Predicted Secondary structure 







Query SS confidence 




































Query Sequence  RTILVPIDISDSELTQRVISHVEEEAKIDDAEVHFLT
Query Conservation 
 


 

 
 
  
  

  
  

      
  

Alig confidence 








.....







....










Template Conservation    
 
 

 .....
  

  
....     





Template Sequence  RKVGAAVDA. . . . . GEAIFRKA. . . . LEEEVDFLIVH
Template Known Secondary structure 


.....S....TT
S
Template Predicted Secondary structure 


.....
....



Template SS confidence 




































   37..40..... ....50... ......60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions