Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABH4
Confidence3.09%DateThu Jan 5 11:15:30 GMT 2012
Rank7Aligned Residues30
% Identity27%Templated2b4va1
SCOP infoPAP/OAS1 substrate-binding domain PAP/OAS1 substrate-binding domain RNA editing terminal uridyl transferase 2, RET2, domain 2
Resolution1.80

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.........80.......
Predicted Secondary structure 








Query SS confidence 
















































Query Sequence  VLLILLYWILALPHRVNVGTGFVMGAILDLISGSTLGVRVLAMSIIAYL
Query Conservation   

  
 
 
  
   
   

  


 
 
 
  

  

   

 

Alig confidence 












...................
















Template Conservation 
   

 


   ................... 
 





 



 

Template Sequence  TAXAVKAWGKATN. . . . . . . . . . . . . . . . . . . GAXLTSYAVTVXFIYYL
Template Known Secondary structure  T

...................

SS
Template Predicted Secondary structure 

...................




Template SS confidence 
















































   295....300....... ..310.........320....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions