Return to main results Retrieve Phyre Job Id

Job DescriptionP23873
Confidence63.69%DateThu Jan 5 11:40:11 GMT 2012
Rank320Aligned Residues33
% Identity21%Templatec3c3wB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:two component transcriptional regulatory protein devr; PDBTitle: crystal structure of the mycobacterium tuberculosis hypoxic response2 regulator dosr
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.........40.........50.........60.......
Predicted Secondary structure 
















Query SS confidence 











































Query Sequence  NGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELS
Query Conservation   



 


   


   

  
 
   
    
  
   
 
 
Alig confidence 





















...........










Template Conservation   
 

 


  
 

  

  
...........   
  

 
 
Template Sequence  EGLTNKQIADRMFLAEKTVKNY. . . . . . . . . . . VSRLLAKLGME
Template Known Secondary structure  TT

T

...........TT

Template Predicted Secondary structure 






...........



Template SS confidence 











































   163......170.........180.... .....190.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions