Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7C8
Confidence2.56%DateThu Jan 5 11:05:22 GMT 2012
Rank23Aligned Residues26
% Identity27%Templatec3lfkC_
PDB info PDB header:unknown functionChain: C: PDB Molecule:marr like protein, tvg0766549; PDBTitle: a reported archaeal mechanosensitive channel is a structural2 homolog of marr-like transcriptional regulators
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   52.......60.........70.........80......
Predicted Secondary structure 




Query SS confidence 


































Query Sequence  TSKYELVEGLVVYFLYFEFIALIVKYFQSGFHFPL
Query Conservation     
 

  

  






 

  
    

 

Alig confidence 

















.........







Template Conservation 






 


 

 
 
......... 






Template Sequence  ENNYDMSQDEVSLLLFLK. . . . . . . . . THGGKIPL
Template Known Secondary structure  GGGGG

.........TTT
Template Predicted Secondary structure 






.........



Template SS confidence 


































   26...30.........40... ......50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions