Return to main results Retrieve Phyre Job Id

Job DescriptionP09099
Confidence70.50%DateWed Jan 25 15:20:14 GMT 2012
Rank152Aligned Residues43
% Identity23%Templatec2p9lA_
PDB info PDB header:structural proteinChain: A: PDB Molecule:actin-like protein 3; PDBTitle: crystal structure of bovine arp2/3 complex
Resolution2.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   390.........400.........410 .........420.........430..
Predicted Secondary structure 





....................





Query SS confidence 




















. . . . . . . . . . . . . . . . . . . .





















Query Sequence  VTLIGGGARSEYWRQMLADIS. . . . . . . . . . . . . . . . . . . . GQQLDYRTGGDVGPALGAARLA
Query Conservation 
   

 
 
    

 


 ....................
 

      
   
 


 

Alig confidence 




















....................





















Template Conservation 


 

 
 



  

  

                       
          
 





Template Sequence  IVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITHHMQRYAVWFGGSMLA
Template Known Secondary structure  SGGG
STTT










TTGGGT
Template Predicted Secondary structure 































Template SS confidence 






























































   319320.........330.........340.........350.........360.........370.........380.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions