Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9P6
Confidence69.09%DateThu Jan 5 11:10:55 GMT 2012
Rank481Aligned Residues27
% Identity22%Templatec2ar7A_
PDB info PDB header:transferaseChain: A: PDB Molecule:adenylate kinase 4; PDBTitle: crystal structure of human adenylate kinase 4, ak4
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   46...50.........60.........70........
Predicted Secondary structure 











Query SS confidence 
































Query Sequence  VLGMAQTGSGKTAAFSLPLLQNLDPELKAPQIL
Query Conservation   
  
 





    
  
  
         
Alig confidence 











......














Template Conservation 
 
 
  




......



 

   
   
Template Sequence  AVILGPPGSGKG. . . . . . TVCQRIAQNFGLQHL
Template Known Secondary structure 

TTSS......T
Template Predicted Secondary structure 





......

Template SS confidence 
































   8.10......... 20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions