Return to main results Retrieve Phyre Job Id

Job DescriptionP04395
Confidence92.22%DateThu Jan 5 10:58:16 GMT 2012
Rank35Aligned Residues30
% Identity37%Templated1bvsa2
SCOP infoSAM domain-like RuvA domain 2-like DNA helicase RuvA subunit, middle domain
Resolution3.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   184.....190.........200.........210.........220.....
Predicted Secondary structure 















Query SS confidence 









































Query Sequence  HLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFAL
Query Conservation    
     
 
        

    
  
 






  


Alig confidence 









............



















Template Conservation   
  

   
............   
  




 


 


 
Template Sequence  ALRQALADSD. . . . . . . . . . . . VASLTRVPGIGRRGAERIVL
Template Known Secondary structure  TTTT
............TSTT

Template Predicted Secondary structure 

............




Template SS confidence 









































   96...100..... ....110.........120.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions