Return to main results Retrieve Phyre Job Id

Job DescriptionP04395
Confidence63.20%DateThu Jan 5 10:58:16 GMT 2012
Rank85Aligned Residues37
% Identity19%Templatec2oceA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein pa5201; PDBTitle: crystal structure of tex family protein pa5201 from2 pseudomonas aeruginosa
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   172.......180.........190.........200.........210.........
Predicted Secondary structure 



















Query SS confidence 















































Query Sequence  LGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWT
Query Conservation   
    

  
   
     
 
        

    
  
 





Alig confidence 















..






.........













Template Conservation   






  

  
 ..  
 
 
.........
  
  
  

 

Template Sequence  SGLNSTLAQNIVAHRD. . ANGAFRT. . . . . . . . . RDELKKVSRLGEKT
Template Known Secondary structure  TT

..


SS.........GGGGGGSSS

Template Predicted Secondary structure 



..





.........




Template SS confidence 















































   514.....520......... 530...... ...540.........550
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions