Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6C5
Confidence55.54%DateThu Jan 5 11:02:49 GMT 2012
Rank229Aligned Residues42
% Identity19%Templatec3iabB_
PDB info PDB header:hydrolase/rnaChain: B: PDB Molecule:ribonucleases p/mrp protein subunit pop7; PDBTitle: crystal structure of rnase p /rnase mrp proteins pop6, pop72 in a complex with the p3 domain of rnase mrp rna
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60.........70....
Predicted Secondary structure 













Query SS confidence 






































































Query Sequence  ERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIGLLHSLGIRLVVVYGARPQIDANLA
Query Conservation       

   
    

  
  
  





  
    
  
  


 
   
  







  
   
 
Alig confidence 






















.............................


















Template Conservation   




 
 


  


      .............................   

 
 
 
 

 


 
Template Sequence  KSTTPYVSALKRINKFLDSVHKQ. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GSSYVAVLGXGKAVEKTLA
Template Known Secondary structure 
SS

.............................T
SGGG
Template Predicted Secondary structure 






.............................



Template SS confidence 






































































   36...40.........50........ .60.........70.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions